PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S05344.10
Common NameJCGZ_06675, LOC105635386
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family LBD
Protein Properties Length: 215aa    MW: 23623.1 Da    PI: 6.2363
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S05344.10genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.42.1e-42591581100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+lrr+Ca++Cvlapyfp ++p kf ++h++FGasn++k+l++lpe +r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+a+la+
  Jcr4S05344.10  59 PCAACKILRRRCAEKCVLAPYFPPTEPYKFTIAHRVFGASNIIKFLQELPEFQRADAVSSMVYEANARIRDPVYGCAGAICHLQKQVNELQAQLAK 154
                    7*********************************************************************************************** PP

         DUF260  97 lkee 100
                    +++e
  Jcr4S05344.10 155 AQAE 158
                    9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.11558159IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-4259156IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
METLDKATSK PISPIAVPSP LFSYSSPSSS PSPSPSSPSQ SSPTNTLPPP PPLPVVLSPC  60
AACKILRRRC AEKCVLAPYF PPTEPYKFTI AHRVFGASNI IKFLQELPEF QRADAVSSMV  120
YEANARIRDP VYGCAGAICH LQKQVNELQA QLAKAQAELV NMQCQQANLV ALICMEMTQS  180
TNNHQEPILQ QQQYIDTSCF LDETNLGTSW EPLWT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4306631e-176KF430663.1 Jatropha curcas microsatellite pJcSSR2595 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012073862.11e-157PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR03e-76LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A067LNW31e-157A0A067LNW3_JATCU; Uncharacterized protein
STRINGPOPTR_0008s04350.11e-106(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-63LOB domain-containing protein 1
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]